PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100210310051
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family Dof
Protein Properties Length: 181aa    MW: 20465.2 Da    PI: 4.2816
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100210310051genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof63.24.7e-20130163235
                        zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCka 35 
                                   ++k+l+cprC+s++tkfCyynny+++qPr+fCk+
  Ote100210310051|100210310051 130 PDKILPCPRCKSMDTKFCYYNNYNVNQPRHFCKS 163
                                   7899*****************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-15125163IPR003851Zinc finger, Dof-type
PfamPF027015.7E-16132163IPR003851Zinc finger, Dof-type
PROSITE profilePS5088417.234134181IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 181 aa     Download sequence    Send to blast
MLKDPEIKLF GRKIFLPENG VAIAVGERSS EYSNESSNGS SDCDRCFQES REEEVREEEK  60
LMQRDEDQAE GEGEVCETNE EDAEESGNTN AISVSDDSPK TPPTDDDVSG DNPKTENGGA  120
NSQQKTLKKP DKILPCPRCK SMDTKFCYYN NYNVNQPRHF CKSXXXXXXX XXXXXGWWHN  180
A
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011087240.17e-43PREDICTED: cyclic dof factor 1
TrEMBLC4B6D71e-34C4B6D7_IPOBA; Dof zinc finger protein
STRINGPGSC0003DMT4000502738e-34(Solanum tuberosum)